gastric juice protein raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
Reviewed 2025-08-17. Anything still debated is marked as such rather than presented as settled.
Evidence in humans is limited. Small clinical studies have examined the peptide in contexts such as ulcerative colitis and wound healing, but participant numbers are small and independent replication is scarce. It is not approved as a medicine by major regulatory agencies and is distributed mainly as a research material or compounded preparation. Long-term human safety data are not established, and questions about absorption through non-injected routes remain open rather than resolved. Claims about its effects are best read against these gaps.
BPC-157 is a synthetic peptide of fifteen amino acids, written in single-letter code as GEPPPGKPADDAGLV. The sequence corresponds to a partial fragment of a protein isolated from human gastric juice, described in early reports as body protection compound. The number 157 refers to a fragment designation in that work rather than to molecular mass. Initial descriptions appeared in the early 1990s, when the fragment was reported to protect gastrointestinal tissue in animal models. Commercial material is produced by solid-phase peptide synthesis rather than extracted from biological sources.
Laboratory research on this peptide has examined a wide and heterogeneous set of endpoints, including gastric ulcer models, tendon and ligament injury, wound closure, and intestinal inflammation. Most published findings come from rodent studies, and reported effect sizes are often large relative to controls. Because the compound has been tested across many unrelated injury models, the literature is frequently described as unusually broad for a single peptide. A substantial share of this work originates from a small number of research groups, which matters when assessing how widely results have been reproduced.
Supplied material is typically a lyophilized white to off-white powder. The peptide is freely soluble in water and in common aqueous buffers, which allows it to be handled as a stock solution. Because the sequence contains no cysteine, disulfide cross-linking is not a route of degradation. The absence of aromatic residues means ultraviolet absorbance at 280 nm is minimal, so quantification usually relies on peptide bond absorbance near 214 nm or on amino acid analysis.
Common synonyms in catalogs include pentadecapeptide BPC 157, BPC157, and the full sequence name. A CAS registry number in the 137525-51-0 range is frequently listed, though the assignment should be verified against the supplier certificate of analysis. The name itself is not a pharmacopoeial designation, and there is no standardized international nonproprietary name. Distinguishing genuine material from related fragments generally requires mass spectrometry, since several truncated sequences share similar chromatographic behavior.
| Property | Value | Notes |
|---|---|---|
| Class | Synthetic peptide | Linear, fifteen residues |
| Sequence | GEPPPGKPADDAGLV | Single-letter amino acid code |
| Approximate mass | 1419 Da | Value reported for the free peptide |
| Reported origin | Fragment of a gastric juice protein | Used as the design template |
| Common synonyms | Body protection compound 157; PL 14736 | Naming varies across papers and suppliers |
BPC-157 is a synthetic pentadecapeptide, meaning it consists of fifteen amino acids joined in a single chain. Its sequence is Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val, a fragment corresponding to part of a larger protein found in human gastric juice. The peptide was first described in the 1990s by researchers in Zagreb who were studying gastric protective factors. It is not a naturally circulating hormone; it is a laboratory-made fragment derived from a stomach protein. The name is an abbreviation of body protection compound, with the number referring to the fragment's position in the source protein.
Most published work on BPC-157 comes from animal experiments rather than controlled human trials. Rodent models have examined its effects on gastrointestinal lesions, tendon and ligament injury, and blood vessel formation. These studies are often small and originate from a limited number of research groups, which affects how broadly the findings can be generalized. No large randomized human trial has been reported in the peer-reviewed literature. Discussion of the compound therefore rests largely on preclinical data, and questions about its effects in people remain open rather than settled.
BPC-157 is a synthetic peptide composed of fifteen amino acid residues, with the sequence Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val. Its name derives from body protection compound, a term used for a protein fraction identified in human gastric juice. Researchers in Zagreb first reported the pentadecapeptide in the early 1990s and described it as a stable fragment of that larger protein. The compound is also catalogued as PL 14736 and, in some commercial contexts, as bepecin. Its molecular formula is C62H98N16O22 and its monoisotopic mass is approximately 1419 daltons.
Most published work on BPC-157 consists of preclinical studies, including rodent models of tissue injury, gastrointestinal lesions, and vascular or tendon damage, together with in vitro cell assays. Reviews frequently note that the mechanisms proposed in these papers remain incompletely characterised and that findings have not been confirmed in large randomised human trials. The compound is widely sold as a research chemical rather than a licensed medicine, and labels commonly carry a statement that it is not for human use. Whether any of the reported animal effects translate to humans is an open question rather than an established result.
Terminology in the literature is not fully standardised. Papers and product listings use BPC-157, BPC 157, and the longer phrase stable gastric pentadecapeptide BPC 157 interchangeably, and synonyms such as bepecin or PL 14736 appear in older or company-linked publications. Purity claims and reported masses can also differ between sources because peptide preparations may include counterions, residual solvents, or bound water. This variability complicates direct comparison of results across studies and makes the exact identity and grade of a given sample worth verifying. Discussions of the compound should therefore specify the source, salt form, and stated purity where those are known.
Heparin, also known as unfractionated heparin (UFH), is a medication and naturally occurring glycosaminoglycan. It is one of the most studied sulfated polysaccharides. Heparin is a blood anticoagulant that increases the activity of antithrombin. It is used in the treatment of heart attacks and unstable angina. It can be given intravenously or by injection under the skin. Its anticoagulant properties make it useful to prevent blood clotting in blood specimen test tubes and kidney dialysis machines. Common side effects include bleeding, pain at the injection site, and low blood platelets. Serious side effects include heparin-induced thrombocytopenia. Greater care is needed in those with poor kidney function. Heparin is contraindicated for suspected cases of vaccine-induced pro-thrombotic immune thrombocytopenia (VIPIT) secondary to SARS-CoV-2 vaccination, as heparin may further increase the risk of bleeding in an anti-PF4/heparin complex autoimmune manner, in favor of alternative anticoagulant medications (such as argatroban or danaparoid). Heparin appears to be relatively safe for use during pregnancy and breastfeeding. Heparin is produced by basophils and mast cells in all mammals. The discovery of heparin was announced in 1916. It is on the World Health Organization's List of Essential Medicines. A fractionated version of heparin, known as low molecular weight heparin, is also available.
=== In popular culture === U-47700 is the title of a 2021 Dutch sci-fi short film by director Erasmo de la Parra. In the film, the characters are addicted to a new drug containing the substance U-47700.
Over the November 2016 Thanksgiving holiday weekend, President-Elect Donald Trump tweeted that he was in talks with Carrier Management to keep the factory in Indiana and not move to Mexico. On November 30, 2016, Carrier announced that it had negotiated an agreement with President-elect Trump and Vice President-elect Mike Pence to continue manufacturing gas furnaces in Indianapolis, in addition to retaining engineering and headquarters staff, preserving more than 1,000 jobs in Indianapolis. The agreement included a state incentive package of about $7 million over 10 years. The number of jobs saved was later revised down to 800. In May 2017, as part of their previously announced plan, Carrier told the state of Indiana that it will cut 632 jobs from its Indianapolis factory. Layoffs began at the end of July 2017, with each worker receiving one week's salary for each year of employment, education and job training, plus 6 months of health insurance as part of the severance package. The New York Times reported on August 10, 2018, that Carrier's Indianapolis furnace plant was plagued by low morale and absenteeism because "employees share a looming sense that a factory shutdown is inevitable — that Carrier has merely postponed the closing until a more politically opportune moment." On November 26, 2018, United Technologies announced that it would spin off UTC Climate, Controls & Security as an independent company known as Carrier Global Corporation. In April 2020, United Technologies announced that the separation and spin-off of Carrier had been completed.
=== Airspheres === These are vast, brown dwarf-sized bubbles of atmosphere enclosed by force fields, and (presumably) set up by an ancient advanced race at least one and a half billion years ago (see: Look to Windward). There is only minimal gravity within an airsphere. They are illuminated by moon-sized orbiting planetoids that emit enormous light beams. Citizens of the Culture live there only very occasionally as guests, usually to study the complex ecosystem of the airspheres and the dominant life-forms: the "dirigible behemothaurs" and "gigalithine lenticular entities", which may be described as inscrutable, ancient intelligences looking similar to a cross between gigantic blimps and whales. The airspheres slowly migrate around the galaxy, taking anywhere from 50 to 100 million years to complete one circuit. In the novels no one knows who created the airspheres or why, but it is presumed that whoever did has long since sublimed but may maintain some obscure link with the behemothaurs and lenticular entities. Guests in the airspheres are not allowed to use any force-field technology, though no reason has been offered for this prohibition. The airspheres resemble in some respects the orbit-sized ring of breathable atmosphere created by Larry Niven in The Integral Trees, but spherical not toroidal, require a force field to retain their integrity, and arose by artificial rather than natural processes.
Sources: en.wikipedia.org
== Properties == The alcohol dehydrogenases comprise a group of several isozymes that catalyse the oxidation of primary and secondary alcohols to aldehydes and ketones, respectively, and also can catalyse the reverse reaction. In mammals this is a redox (reduction/oxidation) reaction involving the coenzyme nicotinamide adenine dinucleotide (NAD+).
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP.
== Non-invasive techniques == Noninvasive neuromodulation encompasses several electroceutical techniques: Acoustic photonic intellectual neurostimulation (APIN); Light therapy (LT); Photobiomodulation (PBM); Low-frequency sound stimulations, including Vibroacoustic therapy (VAT) and Rhythmic auditory stimulation (RAS); a group of transcranial electrical and magnetic methods: Transcranial magnetic stimulation (TMS), Repetitive transcranial magnetic stimulation (rTMS), Transcranial pulsed electromagnetic fields (tPEMF), Transcranial direct current stimulation (tDCS), Transcranial alternating current stimulation (tACS), Transcranial pulsed current stimulation (tPCS), Transcranial random noise stimulation (tRNS), Transcutaneous electrical nerve stimulation (TENS). The general principle of these noninvasive techniques is that they exert their functions through inducing mitochondrial stress.
Sources: en.wikipedia.org
According to the Chinese chronicles of the Jin dynasty (265-316 CE), there were already a thousand Buddhist stupas and temples in Kucha by the 3rd century CE. The earliest painted caves at Kizil are thought to be Cave of the Hippocampi (Cave 118) and Treasure Caves C and B (Caves 83 and 84 respectively). Cave 118, possibly the earliest of the three, is located deep inside the central valley. Cave 83 and 84 are located at the entrance of the same valley. These caves have simple architectural structures, together with paintings in a clear style, reflecting Indian influences. Noble or wealthy Tocharian donors from Kucha, wearing tunics, sometimes appear kneeling at the side of devotional paintings.
== Critical reception == Gordon Freeman quickly became and then remained one of the most popular video game characters ever. In 2008, The Age ranked him as the 16th-best Xbox character of all time, adding that "no one has done more for the reputations and street cred of theoretical physicists than Valve." In 2009, GameDaily listed the "strong and silent type" in their top 25 video game archetypes, using Gordon Freeman as an example. In 2010, Empire ranked him as the number one Greatest Video Game Character, commenting that "the character is the quintessential geek fantasy" who "has become a gaming icon, synonymous with the apotheosis of first-person action." He was also ranked 14th on UGO.com's list of top 100 heroes in all media, with a comment that "an MIT graduate, donning black-framed glasses and a goatee, he's not the guy you'd picture decimating the alien threat." In 2012, GamesRadar ranked him as the sixth "most memorable, influential, and badass" protagonist in games, adding: "It's how the characters of the Half-Life universe treat Gordon Freeman, not the way he treats them, that shape such a compelling character." In 2013, Complex ranked him as the 45th "most badass" video game character of all time. In 1998, readers of GameSpot ranked him as the fifth-best Hero of gaming. In 2009, a public poll on GameSpot resulted in him being voted the All Time Greatest Video Game Hero. He was also voted as the eighth-best video game character of all time in the Guinness World Records Gamer's Edition 2011.
=== Designed nucleic acid systems === Scientists can encode digital information onto a single strand of synthetic DNA. In 2012, George M. Church encoded one of his books about synthetic biology in DNA. The 5.3 Mb of data was more than 1000 times greater than the previous largest amount of information to be stored in synthesized DNA. A similar project encoded the complete sonnets of William Shakespeare in DNA. More generally, algorithms such as NUPACK, ViennaRNA, Ribosome Binding Site Calculator, Cello, and Non-Repetitive Parts Calculator enables the design of new genetic systems. Many technologies have been developed for incorporating unnatural nucleotides and amino acids into nucleic acids and proteins, both in vitro and in vivo. For example, in May 2014, researchers announced that they had successfully introduced two new artificial nucleotides into bacterial DNA. By including individual artificial nucleotides in the culture media, they were able to exchange the bacteria 24 times; they did not generate mRNA or proteins able to use the artificial nucleotides.
Sources: en.wikipedia.org
It is a synthetic fifteen-amino-acid peptide whose sequence matches part of a protein found in human gastric juice. It is made by chemical synthesis, not purified from tissue. The name derives from an early fragment label, not from a molecular weight.
The sequence corresponds to a segment of a naturally occurring gastric protein, so related sequence material exists in the body. The peptide itself as sold and studied is a laboratory-synthesized product. Whether an identical free peptide circulates naturally is not established.
No major regulatory agency has approved it as a medicine for any indication. It appears in research supply channels and, in some jurisdictions, in compounded preparations. Clinical use therefore sits outside standard approved-product pathways, and regulatory status varies by country.
It is a synthetic peptide built from fifteen amino acids, with a mass of roughly 1419 daltons. The sequence is reported to match a fragment of a protein present in human gastric juice. It is not a naturally circulating hormone.